DPCstruct | MC20510
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 215 ± 63 aa |
| Standard deviation of domain lengths | 63.45 |
| Length coefficient of variation | 0.30 |
| Mean AlphaFold2 pLDDT confidence score | 87.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 18.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12672 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C0BIB7 | 9-172 | HCGAPALCGIKPSCLFSVHRKMYEKMKVREWSSEFKKDGRYIIALPKENERMLLFVYDKHLLEKQCTPCCVRKYLKRKRYPVESGFN… |
| Q3A672 | 33-233 | NWLDLAPHFSEDRDCLAAFLALETAEVLAGQKPANLIRINNRMKPCGRNLYQLWQTFGPSLLKGTNLKVICMRNAKDGKLLLFYTPR… |
| A0A1H8ZYL3 | 2-127 | None |
| D6YT25 | 3-280 | None |
| A0A488ABI0 | 11-175 | None |
| A0A1M3CPI0 | 1-206 | None |
| Q6MB73 | 61-344 | None |
| A0A6M2A7C1 | 19-377 | None |
| A0A358UAU8 | 7-143 | None |
| A0A6M1ZSA8 | 3-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.