DPCstruct | MC20506
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 97 ± 9 aa |
| Standard deviation of domain lengths | 9.12 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M7SV71 | 51-138 | NDTAGPCGVPRYNFDLCHSELQGITVTASKPVTGQGQFDNLPPACMVLASALSGDCSEEGPRPTACGVACMLYTGLREDDYAQISEAL |
| E9EBW4 | 31-118 | GRAPPGVPQEEFGRCYDQMNAVTVNADSPGAAGEIRLMGVPPVCMNPANVLVGDPVNGPYALPCGSDCLHYTGLNEQQFNELSDKLHA |
| T0L1K9 | 11-120 | None |
| A0A6A6BJR4 | 91-199 | None |
| L2FN69 | 21-108 | None |
| A0A5N6U0N5 | 612-707 | None |
| A0A0N1P317 | 226-317 | None |
| W2RY79 | 263-374 | None |
| A0A2T4C6E1 | 9-98 | None |
| A0A2B7Y9X2 | 1-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.