DPCstruct | MC20500
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 161 ± 10 aa |
| Standard deviation of domain lengths | 9.63 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 94.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 40.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z5QNX2 | 188-351 | IFLHPDVVFTEEMLRPELQDEAVFADSVDIIVTTHKVVAEHYRADGSIEWAVPPLRALLEIMIDGTSREGWDLTSPEFRALFERENI… |
| A0A7V9G6Q3 | 1-168 | MFDTPTVVFSPELLRPELQDREAFAAGMELIVESQRLAAQAYVDDGSIEEACPPLAAILTVMARGDWQGRGLDHPELRLLFTREHLL… |
| A0A3C0BD75 | 516-676 | None |
| A0A090WPZ5 | 231-397 | None |
| A0A3D4PDC2 | 1-161 | None |
| B0EV86 | 721-851 | None |
| A0A7X7A350 | 35-202 | None |
| A0A317ZM07 | 989-1151 | None |
| M2RSL1 | 130-295 | None |
| A0A847JKL3 | 97-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.