DPCstruct | MC2050
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 59 ± 7 aa |
| Standard deviation of domain lengths | 6.73 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 71.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 55.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07886 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E6Y912 | 76-129 | WRPAPRYYAPRPRYRAALPRAHYNWCFNRYRSYRASDNTFQPYNGPRRRCRSPY |
| I3X692 | 11-65 | GLAIAGAIASPPRRVYSDASSAHVEWCYASYRSYRAYDNTFQPYYGPRQECISPY |
| A0A3S1NM76 | 62-114 | None |
| A0A2G9X2F1 | 42-101 | None |
| A0A7C9R5U3 | 140-207 | None |
| A0A1W2D4L4 | 95-152 | None |
| A0A7W2BQU1 | 70-134 | None |
| A0A1V2SBF8 | 37-89 | None |
| A0A1L3L441 | 5-59 | None |
| A0A011VNM9 | 104-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.