DPCstruct | MC20499
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 380 ± 37 aa |
| Standard deviation of domain lengths | 37.20 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M3I3T9 | 2-361 | LFEQGLADPRGLEYRSIVVRVGSVWGSSHTIQTRGWVIDSFYAIGWNGLVYPVISIGEKQNLQSDILSIVSKDKKERAEYEKKYSGK… |
| A0A7V8J038 | 1-449 | MAFLLIAFPLAADPAADLERILRSLDADDADLRDRAQAELGSWCEATGAEAEAMLKKTRDGVSPEVRARIEEQLGVFERGREVRKEV… |
| B4D3W3 | 58-426 | None |
| A0A5B9W5V5 | 54-447 | None |
| A0A4Q3V8J6 | 14-355 | None |
| A0A517PI80 | 1-428 | None |
| A0A5C1AR58 | 1-391 | None |
| A0A2E0QYZ9 | 16-396 | None |
| A0A7W1VUU9 | 25-383 | None |
| A0A068NUX4 | 9-339 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.