DPCstruct | MC20498
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 232 ± 17 aa |
| Standard deviation of domain lengths | 16.96 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 26.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V8E8H1 | 21-257 | AKVVARQSAALLKAAESNANLGKGALKGDELFDLYVQTVLTEAEKGIAAGGAADAEVRGALGALGLFFDDGVLRAPIIGKSFAGMES… |
| A0A7Y5SIT8 | 180-414 | ADTPQTADALTAGVRRVVLAVREAAAENHARPDGLRGDRLTECLVRRSAAAASQLPRASAPKAFLLGLAAGTDDSSVLRTAPFIHQV… |
| A0A5C5ZKI5 | 424-652 | None |
| A0A7V5PZJ1 | 155-347 | None |
| A0A7C7SWG7 | 47-293 | None |
| A0A3N1JTK0 | 137-382 | None |
| A0A7V4PC68 | 57-303 | None |
| A0A2D6PUT9 | 33-290 | None |
| A0A286RLU4 | 489-740 | None |
| A0A1G5BWL8 | 2-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.