DPCstruct | MC20497
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 149 ± 11 aa |
| Standard deviation of domain lengths | 10.89 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 18.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A848GK15 | 118-252 | ICHFCAAAPHDRKSSIFQPLYQEYERSARQVKFKKMKVEVPRCERCTGFHSKEEGRVGLVFIGVWAAFLLAGYFMKAMIVMGIIGGA… |
| A0A7V8E506 | 14-155 | GATLCCFCEARPPVHGKSCVVSLSKVTDGEGGRLRTLESTVLVPRCAECRAGHMRVMTIGLTVALLGAVAAFLVFVVWKPIDMPGWA… |
| A0A838MJV3 | 258-400 | None |
| A0A7X9RYI5 | 19-159 | None |
| A0A0F9HC68 | 43-213 | None |
| A0A7X8INL7 | 18-171 | None |
| A0A562V1Q1 | 2-152 | None |
| A0A7C0VMT3 | 6-145 | None |
| A0A6P2B5E6 | 430-591 | None |
| A0A847L6F5 | 6-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.