DPCstruct | MC20495
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 160 ± 12 aa |
| Standard deviation of domain lengths | 12.01 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 24.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A830HFQ3 | 155-310 | NASMWDEAYSTGSFGNPNPQTTNQASFDAAFEATGMAVRVCADCSRNQKTIVYKRITPMNGTSFSAYNNFFVTWATSAHGPNVLNRD… |
| A0A830H7S6 | 40-192 | DTDNWLKVFSKGTVFGEYVPQNAEQVFNDAFALNGIVVRLCDDCLSTHKQIVYARKSPTTDSFNAYQNFLITWRSAKNTLNQDFELY… |
| A0A812KU63 | 534-676 | None |
| A0A7S0PT32 | 14-167 | None |
| A0A6T9Y978 | 231-384 | None |
| A0A7S1D214 | 7-163 | None |
| A0A7S0C664 | 266-421 | None |
| K0REE3 | 435-591 | None |
| L1IBL9 | 134-303 | None |
| A0A7S2W887 | 29-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.