DPCstruct | MC20492
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 142 ± 23 aa |
| Standard deviation of domain lengths | 23.15 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00940 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M0ZLT2 | 108-234 | PVRWTTPLGLPVVQPYRKIGRHFIKTSLQILTLQRETEKVMVKRQRTAFPPNFIHSLDGSHMMMTAVACRRAGLNFAGVHDSYWTHA… |
| A0A7S2AMA4 | 156-296 | MVCVQPYRKVDNKKINTVLQTISVDIHSEALPVVSAKQRSAFAPNYVHSIDSAHMMKTAEECIGRGMDFAGVHDSFWTHPCSVDEMN… |
| A0A291P582 | 1-134 | None |
| A0A183WN36 | 186-331 | None |
| A2YYV2 | 698-845 | None |
| A0A661GGQ8 | 82-235 | None |
| A0A2G2WM34 | 135-276 | None |
| A0A445CUN6 | 104-239 | None |
| A0A7S2ABX9 | 2-119 | None |
| A0A7J0G7U8 | 80-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.