DPCstruct | MC20491
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 200 ± 37 aa |
| Standard deviation of domain lengths | 37.44 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2SUN2 | 6-185 | LWPKLGDMGVDTSLFGQCLTRFGILAGSECVKIDEEVISLISSVLSKEFDAVSDVPKQYRWTKKPSPSSHSAYITTAHSKLDDFVSE… |
| A0A7R9SZ17 | 25-225 | AVRAMAPLGDAAAVAIRSALHDIADDRMEKIAVRIRELLVTPLATKCCGMLKQLRGITATYRMTNKPAPERASHYVPSVLAPLRTFV… |
| A0A5B6W2R2 | 23-223 | None |
| A0A7S3C6T2 | 87-297 | None |
| A0A7R9ZL98 | 11-166 | None |
| A0A2A2KME3 | 406-600 | None |
| A0A146I9S7 | 612-841 | None |
| E3K8M4 | 83-249 | None |
| A0A5N4DJZ7 | 111-352 | None |
| F8NV43 | 569-790 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.