DPCstruct | MC20490
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 89 ± 16 aa |
| Standard deviation of domain lengths | 15.81 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 48.74 |
| Pfam Score | 92.17 |
| Assigned Pfam label(s) | PF06421- CL0299- CL0437- CL0193 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9SWG4 | 18-102 | QSTGSELITSLAENISRRQYDVILQASVANRILARTTVKAVRRDVTSKCYGGDVSRKKKLLEKQKEGKKKMKALGARSSSASEDV |
| A0A7V0P1L0 | 10-79 | DRLKNEIPRHQFKIAIQGAIGGKIISRSTVSPFRKDVTAKCYGGDITRKRKLLEKQKKGKKRMKIVGSVM |
| A0A7S2KSF0 | 17-113 | None |
| A0A655SNR4 | 75-175 | None |
| A0A1R3KGV7 | 563-660 | None |
| K1ZGY9 | 4-72 | None |
| A0A1A9VK53 | 504-579 | None |
| A0A7V0RL11 | 91-187 | None |
| A0A449BEB7 | 523-614 | None |
| A0A7R8H7I7 | 897-985 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.