DPCstruct | MC20487
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 192 ± 35 aa |
| Standard deviation of domain lengths | 34.86 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 24.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G4CUW9 | 35-219 | AQRQSREVEARRAKAIEAKVSQMRQETEEDVTTFGEALRDLDMEMIGKEVSAEGRKDWNMALDCYDRAKTLMAQDKGTRSIPLVTET… |
| A0A011ABG4 | 19-188 | IVGVADAALKTDVEAGRNELLRVNSVLRADLERLRVHAGTGPMNTVLLRAAQNVEAFGSAGFAGGRHLFRATEAMAEAGRLIAPTGR… |
| S0EXM5 | 199-433 | None |
| S3BKN5 | 281-499 | None |
| A0A2S6XHJ3 | 24-168 | None |
| A0A4Q5J2C7 | 6-179 | None |
| A0A1Z1WSV6 | 9-133 | None |
| A0A7Y1SY15 | 50-262 | None |
| V4KDS5 | 417-651 | None |
| A0A7Y5ES46 | 2-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.