DPCstruct | MC20484
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 233 ± 25 aa |
| Standard deviation of domain lengths | 24.70 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 16.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07793 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A106BVR5 | 27-249 | APESVLRRLQAAWVPQMASLYVAESGEGPDWRAACHTLQQLFLSLQAPDGDATRESRLQSIPSINAALRRGLLAQGAEPAQLKDFFS… |
| A0A1H2V4M2 | 182-420 | DQWQRDAQRRAERSVKLRERLLQSESGIARQRRADQTAKAAVGRALANRHLPLAVANFIHDYWLPLMRQVAFSNGVDAAQWRHANKL… |
| A0A2E8F4T5 | 182-384 | None |
| A0A2E8J463 | 17-236 | None |
| A0A657B6I3 | 422-665 | None |
| A0A3B0XWB0 | 47-253 | None |
| A0A1G3Y395 | 2-209 | None |
| A0A1S9CY75 | 527-726 | None |
| A0A2D9ZYD7 | 592-806 | None |
| A0A5C7K9Y1 | 236-448 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.