DPCstruct | MC2048
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 158 ± 19 aa |
| Standard deviation of domain lengths | 18.80 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 15.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A416C4T5 | 5-171 | MNFQMKNIKTLTGRKGYGCTASLYLDGKRIGTYADYADGGPEDVEYISKEAEEAMMKTIIAYAKKVPNKFVINLYQKRPEQYKKECE… |
| A0A1M5GQF2 | 1-159 | MNIELKNIKYYESFSEETLAFQASLYIEGKRVGTAKNDGRGGPTYYDGDNKEGRELIHQAEQYAKALPDKHYPKDDYMEAFSIPMTL… |
| A0A1H7IDM5 | 224-398 | None |
| A0A1H7IIY9 | 3-165 | None |
| A0A545ANE0 | 415-601 | None |
| A0A242CVW0 | 13-169 | None |
| A0A5M9GQ08 | 1-143 | None |
| A0A512PB48 | 13-153 | None |
| A0A3S0TQE5 | 1-144 | None |
| A0A7W8VB43 | 4-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.