DPCstruct | MC20477
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 68 ± 9 aa |
| Standard deviation of domain lengths | 9.13 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.87 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 52.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y6DR84 | 42-115 | GCCDDSLNRHATAHFAVTGHEVMQSFEPGEGWFWDFVAQDFVDGPRLADPQAHPTTQSVPGPADRLPRDWSEQL |
| A0A1G8VWJ5 | 1-76 | MGCCDSSPAQHASRHYRETGHRYMQSYEPGEEWFWDFENQEAVRGVVLAGPTSRPESQPSPAPADRVPEDWQQHLN |
| J7L5M4 | 1-64 | None |
| A0A1Y2N8E0 | 222-297 | None |
| A0A5P8ZVL0 | 2-57 | None |
| A0A0D5AHQ7 | 1-53 | None |
| A0A0H5RZ39 | 13-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.