DPCstruct | MC20476
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 82 ± 6 aa |
| Standard deviation of domain lengths | 5.69 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 72.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12134 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9DUZ5 | 123-198 | ILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSAQRQQIAE |
| A0A1U8Q1G5 | 1-88 | MLLKPDKTIITEPHNIWPSLTDDQWMKVEVALRNLILSDYAKKNNVNTSALTQSKIRDIILGTEITQPSQQRQQIAEIEKQVIFSSYA |
| A0A0B1SWK9 | 232-316 | None |
| C4YMR9 | 331-415 | None |
| M4BI32 | 262-346 | None |
| A0A1R3IFY8 | 39-107 | None |
| A0A1J8Q4P6 | 92-155 | None |
| G3IPB5 | 86-166 | None |
| A0A5E4G278 | 271-356 | None |
| A0A251RYI1 | 39-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.