DPCstruct | MC20475
Metacluster Properties and Pfam Annotations
| Number of structural domains | 895 |
|---|---|
| Mean domain length (aa) | 99 ± 20 aa |
| Standard deviation of domain lengths | 20.01 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 77.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 19.60 |
| Pfam Score | 95.69 |
| Assigned Pfam label(s) | PF12235- PF16544- PF20776- PF16275- CL0007 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6T1GG78 | 502-576 | GPPDLPTGTEVIEQKCVAYLIGKGGQALAAINAAAGVSIQIDQSTKTFGWSMANIYGTEEGAAKAKMILRQKVSE |
| A0A1U8BM51 | 5-94 | SSSNVPQQAPVITQVTQHMQIPLSYADAVIGTAGASISYIRRASGATITIQETRGVPGEMTVEINGSASQVQAAQQLIQNFMAEAAG… |
| A0A7R9KH04 | 79-180 | None |
| A0A7R9SYY0 | 58-151 | None |
| A0A7R9T408 | 472-547 | None |
| A0A6S7GB33 | 295-414 | None |
| A0A5B7DTG2 | 46-102 | None |
| A0A7S2SQI6 | 96-193 | None |
| A0A0C2JGQ9 | 50-136 | None |
| A0A7S3ZQU3 | 202-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.