DPCstruct | MC20473
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 119 ± 13 aa |
| Standard deviation of domain lengths | 13.47 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 37.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09349 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A445DZL9 | 29-140 | NKATVQELHEWRLMYEEKFGYVLVTFVTGRTSKDILAELKTQFNNTHVVELEIASKEKLKYIERSIRELLSKKSVQTTDDGNVSAKY… |
| A0A1U8B9X6 | 1-141 | CNSSLQELVEWNNRYRQKFGLVFLICASERSTPEILEELKKRYPNRPIVEFEIAAQEEMKIIELRLAKLFAAKAEVTSPMDRVRIIG… |
| A0A445EFR4 | 38-143 | None |
| A0A444X0S5 | 1-98 | None |
| A0A445CAV2 | 55-174 | None |
| A0A1G9LGX6 | 89-205 | None |
| A0A445AJF2 | 2-123 | None |
| A0A5N6M5R1 | 87-198 | None |
| A0A445E5P6 | 143-266 | None |
| A0A445DU34 | 52-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.