DPCstruct | MC20472
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 120 ± 10 aa |
| Standard deviation of domain lengths | 9.74 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 34.07 |
| Pfam Score | 75.56 |
| Assigned Pfam label(s) | CL0167- CL0063- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9XY20 | 1-111 | APECPHGPTLLFTRTLPGKGEARRFYACSACRERKGCHFFQWEDEQISEARLSAREKFNQSHRPSRTHSDNIKRYKEFIALPPAKRR… |
| A0A671QQR8 | 6-108 | RVFLRTALLFEKTGNGEEGGRRFYTCSACRDRKDCNFFQWADKKISEARMLAREEQNRSKMPLFKFVSLPLEQRRFCVDCQLLILPG… |
| A0A7R9PPZ8 | 40-171 | None |
| A0A834PBK7 | 2-141 | None |
| A0A4Y2IN16 | 2-120 | None |
| A0A7I8VA95 | 6-130 | None |
| A0A6A4WL66 | 2-102 | None |
| A0A7R9J8Z8 | 59-172 | None |
| A0A7M4EAM8 | 94-221 | None |
| A0A833WAC2 | 2-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.