DPCstruct | MC20471
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 399 ± 52 aa |
| Standard deviation of domain lengths | 51.81 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16533- CL0003 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2RTZ1 | 29-322 | TDCTTGALIQLGVHNWTVDQTVEWLITQVELPQYEHNFRNNGVNGAVLPLLAQNTHNFISHNLGIKDSISKQKIALKAMDVVLFGPP… |
| A0A671QPY9 | 54-485 | MTEADRFSLEALQHIHREMDDDQDGGIEVEESVEFIIEDMQQQQQANKHSKLHHEDQHITLEELWKGWKSSEVHNWTQEDVLRWLRE… |
| A0A0N5ADQ6 | 4-346 | None |
| F6TB84 | 51-398 | None |
| A0A132ABL4 | 14-444 | None |
| A0A5K3EW12 | 37-493 | None |
| A0A803KHX8 | 13-359 | None |
| A0A1I8IKN4 | 2-345 | None |
| A0A820TSY8 | 1-479 | None |
| A0A835NP22 | 6-374 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.