DPCstruct | MC2047
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 120 ± 10 aa |
| Standard deviation of domain lengths | 10.18 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W9MZY0 | 6-128 | AAPVRLVARSDAPARPRTTVAVECVLELELADGRRVPLLTDRGWSSSAGWDGLTPSEVAETAVTVTGPDEPAPGMTAAQEEDAHWEH… |
| A0A1H1WSR2 | 1-124 | MAVGAWCSNRFAHEPRPERNYLSIQIDEFAELSDGTRFSLRWDRGVTVSWDNESANEPVSEQEVLIHLEAGLLPDEGEVADEGQARS… |
| A0A849BEP3 | 5-143 | None |
| A0A4Q5N2M6 | 65-191 | None |
| A0A4Y9F383 | 4-116 | None |
| A0A5C2FSS2 | 7-126 | None |
| A0A495JSP3 | 24-149 | None |
| A0A4R4QPL8 | 3-105 | None |
| A0A7Y9Z9E6 | 26-151 | None |
| I4EGN9 | 49-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.