DPCstruct | MC20468
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 158 ± 24 aa |
| Standard deviation of domain lengths | 23.64 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 24.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9EVA8 | 7-131 | KIVFNCFSMISSALGSEESLTYAVHLLGPLYKASEGFAGKVVSDEVKQLAESVRDKLRNRIGVEKFVEVYNGVRKGLKQKRESRKQA… |
| A0A7S1X5B8 | 14-163 | GVSAMGLLRRMCRMADDKTYGRQTQRLAALRWIAATATSLRSDLRPTFFPLMLIPLYRICEGAAPSPDPVKDLATEVLSHLRETTDS… |
| B0CP40 | 5-114 | None |
| A0A7S1F483 | 167-346 | None |
| A0A7S0BSY6 | 170-365 | None |
| A0A7S4K3G7 | 63-231 | None |
| A0A498MUQ7 | 2-151 | None |
| A0A7R9VK46 | 136-314 | None |
| A0A835R9U3 | 160-304 | None |
| A0A7E4W8V1 | 160-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.