DPCstruct | MC20467
Metacluster Properties and Pfam Annotations
| Number of structural domains | 104 |
|---|---|
| Mean domain length (aa) | 117 ± 25 aa |
| Standard deviation of domain lengths | 25.49 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 85.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 24.65 |
| Pfam Score | 85.74 |
| Assigned Pfam label(s) | PF19278- PF02538- CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0WB80 | 1-63 | PVFFAEAGDYVDCPIYDRYALPAGATLAGPAVVEEFDSTTVVHPGFSLGVDDVGNLTIEKEDS |
| A0A836X4L9 | 49-136 | DRVGNGIRPTYKGSLFLGHADEALTGSCSMFLPDISEQLDTPVYDSEKMKPGAWFQGPGIIEVRDTTIYVPREATVERDGYLNFILKL |
| A0A146IMS9 | 185-304 | None |
| A0A6J3CF78 | 20-138 | None |
| A0A432QU89 | 142-258 | None |
| A0A7G2M0S1 | 289-409 | None |
| K2S7Q5 | 133-258 | None |
| H0EM88 | 484-627 | None |
| E7F6Z6 | 619-737 | None |
| A0A317WHJ4 | 492-624 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.