DPCstruct | MC20465
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 63 ± 5 aa |
| Standard deviation of domain lengths | 5.00 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 48.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A836T815 | 1-58 | GSCCIAERRMIETLDEGEPKTSFLKNGDRVRIEMLNRHGRSIFGAINQTVVVTKGEGR |
| A0A2X1R7B8 | 163-229 | TVSNVDRSKGSSCIAEKRMLEIIAEGKAHTPFMQYGDTIRIEMLNQQGQSIFGAIEQTVTRYKGPEK |
| A0A850BTI8 | 94-158 | None |
| A0A560HVK5 | 1-64 | None |
| A0A7W6CJD6 | 1-51 | None |
| A0A354VI98 | 1-67 | None |
| A0A653JW17 | 24-89 | None |
| A0A2D7CRB7 | 28-89 | None |
| A0A6J5H1T8 | 47-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.