DPCstruct | MC20463
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 127 ± 23 aa |
| Standard deviation of domain lengths | 22.70 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151AYU2 | 1-147 | MFRCIICLRELDNATASEEHIFPEALGGNITIKNVCRECNSKLGRYVDAPLINNWLIEAKRMLLCLPGKSGKIPNPLEKGYIAGDPQ… |
| A0A125Y9Q8 | 1-127 | MKKCIICRKNRVEFSDEHVIPDSINGYYHIYTVCKTCNSKLGQYIDEPLTNHKFMEFQRNIRRIPGKKGKVPNPLDGVHYFKDEEDI… |
| A0A807ZN11 | 2-134 | None |
| A0A840RS51 | 1-129 | None |
| A0A521DNJ8 | 1-89 | None |
| A0A7W0P8L5 | 10-118 | None |
| A0A4V3A2J6 | 2-106 | None |
| A0A7R6Y057 | 1-147 | None |
| A0A7V1F6U3 | 4-139 | None |
| A0A7C6V2G0 | 2-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.