DPCstruct | MC20461
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 192 ± 28 aa |
| Standard deviation of domain lengths | 28.38 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 30.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A199VR63 | 178-347 | RCRNIACQSALPADECRCDICSSRSGFCNLCMCVICSKFDFEVNTCRWIGCDQCSHWTHTDCAIRVGQIGTGLSVKNGVSHPEMLFR… |
| K4C6A5 | 1-202 | MQPLLSDSPFGVITCKAGNRICSSLTAENPLTSTRFCDLCCSEHGFCGDCCCILCGKLIVLDYDGYSYIRCEATVVDGHICGHVSHL… |
| A0A4Y7IEJ0 | 219-360 | None |
| A0A7J7PBE4 | 65-304 | None |
| A0A6A2YAI1 | 1-270 | None |
| M7Z1H7 | 313-490 | None |
| A0A068V2X2 | 1-172 | None |
| A0A287XIY9 | 46-265 | None |
| A0A7C9DSI7 | 1-161 | None |
| A0A2K2DMI5 | 85-293 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.