DPCstruct | MC20460
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 113 ± 19 aa |
| Standard deviation of domain lengths | 19.48 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 71.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 45.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10536 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A438J4V9 | 56-161 | QELQAFARFLRVCKLVGVDDSMEWYFPHRVGMQFGMDQDLPGYVHPCNGTPEVAWNNYSKPINGVKLYIPSRFFEADVTTRYLEWWN… |
| A0A3Q7GT28 | 1-92 | MESFVQCLRVSKLAGLGCQDPYQPNRVAMQFGYDQDFPKWIPHSHSSPELAWYNYSIPITSDLRLYYPSRLFEPNVTTRYLKWWRNE… |
| A0A5C7IEL2 | 7-139 | None |
| A0A2U1LFC7 | 24-118 | None |
| A0A0L9V8P4 | 108-216 | None |
| A0A218X7R5 | 154-262 | None |
| A0A3Q7YB87 | 89-227 | None |
| A0A7C8ZRU5 | 21-129 | None |
| A0A834FU46 | 99-194 | None |
| A0A314ZBP5 | 53-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.