DPCstruct | MC2046
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 183 ± 8 aa |
| Standard deviation of domain lengths | 8.13 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 83.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B2EBU3 | 69-244 | SRDLRLMKVRASQWRAGVWFDPEGVQWVVAAGLAKGGHRDHEDFYQRLERQCDTERGRKALLPTDEDARLLKRETAARALTDWELAV… |
| A0A1H1PPP9 | 3-191 | RWRGAATDSDLIGEGEVWLCAGGLRAAGDDRDFYRSFMSRVAAGGAEQFLPDEDDRRLQRVETKIARREAWARQIQLSVLVCLERAY… |
| A0A543C9J2 | 77-249 | None |
| A0A838H0J2 | 23-189 | None |
| A0A7K1UH64 | 1-196 | None |
| A0A285HFV6 | 9-192 | None |
| A0A7W9E741 | 59-239 | None |
| A0A1L7D198 | 17-206 | None |
| A0A542R804 | 63-245 | None |
| A0A5C5USV1 | 83-272 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.