DPCstruct | MC20455
Metacluster Properties and Pfam Annotations
| Number of structural domains | 2024 |
|---|---|
| Mean domain length (aa) | 216 ± 48 aa |
| Standard deviation of domain lengths | 47.70 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 77.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 13.83 |
| Pfam Score | 97.92 |
| Assigned Pfam label(s) | PF03004- CL0125- PF01827- PF03421- CL0094 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834CBH7 | 4-164 | LVERSKDPNLPSVNTFNTFFYPKLCSNGYYAVRRWTKKMDIFAKDILLVPIHLGMHWCLSVVDFRKKSITYFDSMGGKNDKACQALF… |
| A0A1J8QVK5 | 55-258 | PSQGGFPHQIFEPKDIALLASLTACLNDVCINGCAVLLFSKLNNLAIPVHCALLSSHDLPHIRYNAPDVILWRNVSWTSYWEKDIWI… |
| A0A226EL90 | 32-236 | None |
| A0A0S2C989 | 3-247 | None |
| A0A2G3CH66 | 9-164 | None |
| A0A2G3CMR1 | 2-207 | None |
| A0A2G3CS09 | 13-205 | None |
| A0A2G3D518 | 8-181 | None |
| A0A2G3D0Y1 | 8-204 | None |
| A0A6A5Y761 | 14-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.