DPCstruct | MC20453
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 257 ± 28 aa |
| Standard deviation of domain lengths | 27.86 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 36.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2A7N4 | 1-269 | VSHRIWALVIDALRDAGARVEGIASFTWDEIRDISRFCSSPVKEIFFFHSAGDLQQACHAGQIKEGDSVFFNAGSLLWDKSDGTDTR… |
| A0A7S4WB61 | 968-1248 | DSIAILKDIMKCNAPFGLVLDIKSRHVPKRIWGIVIDALREAGARVEGIGTFSMEDIRDISAYCSSPVKEICFFHTAGDLQMACHEG… |
| K0S761 | 689-911 | None |
| B8C3J1 | 811-1080 | None |
| A0A7S0CIT9 | 1-204 | None |
| A0A7S0C2Z1 | 1-291 | None |
| A0A7R9WQV3 | 3-273 | None |
| B7FWS3 | 502-765 | None |
| A0A482RK67 | 70-287 | None |
| A0A7S4VMX7 | 461-743 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.