DPCstruct | MC20451
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 261 ± 22 aa |
| Standard deviation of domain lengths | 21.81 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 40.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4IFA2 | 76-345 | LWNSGDKAAPAFPANSKLTGVRVTLRAPPWSAVGFAAGVPGFAFWYDPRAELLAYGTNMLDALSASLKGAPPPRMARAHLLAHRYAK… |
| A0A7S1ZDZ7 | 1-233 | WFRQTDPEPSVVYGTDILREFKVPEEEDPLCTRVHMIAHRYATGQKAETPKDKVSYHSAALLEWDHGKHCTIFEIGWLGGIGGYRGK… |
| B7FSN4 | 208-476 | None |
| A0A7S3PKZ4 | 139-380 | None |
| A0A6U0ZRV6 | 268-545 | None |
| A0A812Y7S5 | 274-526 | None |
| A0A7S0CW06 | 252-548 | None |
| A0A7S4K8M2 | 300-554 | None |
| A0A6U3U3R2 | 1-286 | None |
| F0YIJ6 | 222-448 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.