DPCstruct | MC20450
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 281 ± 36 aa |
| Standard deviation of domain lengths | 35.77 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 24.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1Z0Y1 | 1-277 | VLGLECRKAYVDVYADSIHAPGAVICCDGSDSGGAFASGLCSAEGLPLTRQLTRFPDGWLIPLVPIGLRFLAITYGKLMSGKGLGLE… |
| A0A485LWP1 | 129-364 | PFVVVNAAVALLVAYCFFAQPMKYVRITGECKSNWLFLGTPNNEPICCETSNAAPCYAGMDTIQFISHGQGAWVLPLAVVLFNFGAT… |
| A0A024GM02 | 12-289 | None |
| A0A1E7F569 | 24-327 | None |
| B7GAT4 | 160-507 | None |
| A0A7S2V6Y4 | 11-300 | None |
| A0A7S2H8X0 | 19-246 | None |
| A0A7S3DYQ6 | 101-447 | None |
| D8LG45 | 5-300 | None |
| A0A2D4BIX4 | 25-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.