DPCstruct | MC2045
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 122 ± 7 aa |
| Standard deviation of domain lengths | 6.76 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z5YPH5 | 42-166 | DPTALISTPDQAVTAASTMMQMSAVGLGSGIDQVSDAGIWEANTEAPLAAMLYAASPRGHGKGIEWVLLAVDNLENDDNAPDAPGWH… |
| A0A1X1YHR6 | 2-116 | LACTPQLALTLAEGLLHSAAAREGDSYAVWVSNATLPLAGLLYAARQDNLGIGWVLDAAANTYRDVDEHEPGWVNAAQRVADAPLLA… |
| R4UIX4 | 7-118 | None |
| A0A7I7PC43 | 124-252 | None |
| A0A4R5PDS8 | 2-130 | None |
| X7VBB9 | 18-140 | None |
| A0A1X1YYE6 | 54-179 | None |
| A0A1E8Q3C7 | 97-218 | None |
| A0A1X2FC46 | 15-131 | None |
| A0A0M2JV23 | 67-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.