DPCstruct | MC20449
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 118 ± 14 aa |
| Standard deviation of domain lengths | 13.98 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 92.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 53.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1YVM5 | 1-110 | YPEGSPKPPSWPAMHSAASNISFWLRVLFKLTPDQFCEAKKVDYAVSYARTVAGVHYPGDNIAGLNMGQDIIARELPSFLSKKYESN… |
| A0A1Z5K0G0 | 332-437 | YPEGSPSHPAWPAMHSAASAASFWLSVVTNLTPEQYCEALRVDYGVAFARTVAGVHYPGDNIMGLNLGQAILADRMPEHFAENFGAD… |
| A0A7S2HVQ8 | 115-239 | None |
| A0A7S1GQ18 | 1-120 | None |
| A0A7S0BVU2 | 56-187 | None |
| A0A1E7EU71 | 387-492 | None |
| A0A6T6HJX8 | 72-193 | None |
| A0A7S0CKD1 | 17-150 | None |
| A0A6V2Y3Y8 | 298-402 | None |
| A0A7S1YE69 | 36-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.