DPCstruct | MC20446
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 72 ± 4 aa |
| Standard deviation of domain lengths | 3.83 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 60.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E9ILR7 | 3-79 | GIRIGPVVKKDVMKASIMLEHDSQYATILAFDVKIERDAQELADSLGVKIFQADIIYHLFDKFTNYREELKQRKRDE |
| W9R854 | 7-79 | SAVYLRDAMRTSGMLEKKTELAVIFAFGVDVTPGAWQLSAELGVKVFTADTIADLRHTFKAYIHYAKEANNEK |
| Q56WR4 | 1-65 | None |
| A0A7R9AM06 | 29-105 | None |
| A0A0A9CX58 | 3-73 | None |
| W9S6Q4 | 1-68 | None |
| A0A1B0CAW0 | 3-73 | None |
| A0A3P6H9H5 | 3-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.