DPCstruct | MC20445
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 65 ± 5 aa |
| Standard deviation of domain lengths | 4.88 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 76.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 73.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0491 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y7IMP3 | 1-65 | MPSIQTALPPELVNNARRLYRECLRRAKYVGHRQNNTPLLVDMIRQQFKKNMLETNPEKIQTMMD |
| W9R840 | 1-74 | MPSLQTALPPELANNAIRLYRECLRRAKYIGHKTNAELMMQQHNTELLVDMVRQQFKRHMHEKDPEKIQKLKDE |
| A0A2I0K297 | 1-56 | None |
| A0A7J7L6Y4 | 25-97 | None |
| A0A445BKY9 | 1-66 | None |
| A0A7J7E0Z2 | 89-153 | None |
| C7JA64 | 54-118 | None |
| A0A7J7GFB3 | 129-193 | None |
| A0A445GT68 | 68-132 | None |
| A0A804NXG9 | 17-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.