DPCstruct | MC2044
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 65 ± 6 aa |
| Standard deviation of domain lengths | 6.41 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 46.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X3P4U6 | 1-67 | MLVREIARKVGITERAAQRILADLIADGYVDKEREGRRNRYRIHRDRPLRHPLERHHSIGELLATLG |
| A0A2Z5YML5 | 3-60 | IGITERSVQAILTDLTDENYLIKSKVGRRNVYELNPEGRLRHPLEASHTVGELVEALS |
| A0A5C6EFV3 | 1-67 | None |
| A0A542UIY6 | 51-131 | None |
| A0A4R8VHL6 | 23-85 | None |
| A0A7X1U0Q3 | 42-106 | None |
| A0A066YST2 | 1-56 | None |
| A0A5B1C9F0 | 40-105 | None |
| A0A0A0JEN1 | 11-78 | None |
| A0A661FYY7 | 2-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.