DPCstruct | MC20439
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 237 ± 27 aa |
| Standard deviation of domain lengths | 27.45 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 70.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 42.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453HP59 | 58-294 | LHQRKEPVCPSLQFSLMGKKLYISQEQVSVGRKPITGLRLCLEGAKQNRLCIQLQHLASLPKILKPYWDAHITIGAAKWQGPEEQDS… |
| W9QIA8 | 184-429 | LHMKVSKKHVALQVSTDQKPVVGLRLYLEGKKCNQLALHVQHLSSLPDSMNVSFDDNSKKRPCRWRGSDDYEFSNQFLEPVRWKRYS… |
| A0A0E0A7P6 | 14-244 | None |
| M7YW86 | 44-330 | None |
| A0A540KGD2 | 292-505 | None |
| A0A7G2DXC7 | 233-466 | None |
| A0A1R3JGJ2 | 329-576 | None |
| A0A6A5MPK4 | 322-564 | None |
| I0J3C3 | 52-257 | None |
| A0A835DRY7 | 385-606 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.