DPCstruct | MC20438
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 83 ± 8 aa |
| Standard deviation of domain lengths | 7.80 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 39.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06830 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R0JRP6 | 1-82 | MEITKVSSILIVVLLFVSCISQANAYYYQQCSTKGTRCYEKYVRWPTECPSNESTDPKAKVSQIDCDKSICRAVCRSRKPNC |
| W9QHS6 | 1-81 | MESFKRSSTLVLLIVLVSFVVHEASAYYYKYCDAYSRCSGKTLICPSECPGTTSKHQKAKVCYIDCNKPVCKAECRRKFMP |
| A0A438DLV0 | 1-79 | None |
| A0A151TPH6 | 1-83 | None |
| A0A5N6NNZ5 | 1-101 | None |
| A0A6A5MLL7 | 1-81 | None |
| A0A5J4ZDG8 | 1-87 | None |
| B9T646 | 9-78 | None |
| A0A118K6A5 | 1-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.