DPCstruct | MC20435
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 235 ± 46 aa |
| Standard deviation of domain lengths | 45.62 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B0HTG7 | 12-206 | LLIDYYDVKQQLGRRPTYLELHLHGRSIAKEYRDEFKSYVGFLYWADELSEREKEVFLRYESWLVEVERTTMTKSYKMVVLQAMLNR… |
| A0A069DHS5 | 434-646 | QLEEAIAVEKKLIGSGKRKENAVIAYRELKKKLGRRPNYIELHEQGSIVSQEYRSLFDSYINFLFLANELDKEEASVAKRYLKWFQE… |
| A0A4R1PLT3 | 2-171 | None |
| A0A3E1ESA8 | 699-933 | None |
| A0A3C1GMR2 | 44-252 | None |
| A0A1Q9GY70 | 97-336 | None |
| A0A7K2ACM5 | 472-707 | None |
| A0A521UH50 | 605-877 | None |
| A0A380GZF6 | 9-240 | None |
| G2FN89 | 24-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.