DPCstruct | MC20432
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 69 ± 13 aa |
| Standard deviation of domain lengths | 12.68 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 52.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090Z2S7 | 35-88 | MPRIRNWKHLKLFRPNTQDNYEHIDELFSGEINWSMIENHYPDMLRIAMSIKAG |
| A0A1N7SKG9 | 1-67 | MPRMLNIKDLVIYKADRRRKYAHIDSLCRKTIDWELTERHYPDMMRVAVSIKAGRWYLRRSSTVARR |
| A0A1G8FW64 | 70-123 | None |
| A0A1G4EPV2 | 214-297 | None |
| C2SU40 | 13-79 | None |
| A0A5P8WJB0 | 1-61 | None |
| A0A5Q4ZH28 | 1-63 | None |
| A0A3A0AKT9 | 1-90 | None |
| A0A1C3PAZ7 | 5-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.