DPCstruct | MC2043
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 217 ± 31 aa |
| Standard deviation of domain lengths | 31.37 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 39.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0505- CL0352 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0U0W8I5 | 8-185 | PEFVTAAASDLARIGSTVSTANAAALAPTTGVLAAGADEVSAGIAAVFDAHAQAYQALSAQAAGFHDQFVQLMNAGAGQYAAAEAAN… |
| A0A2Z5YL54 | 31-284 | VASGYLGWLASTGVQAGQAASQARIAAAAFEATVAATVHPVAVLANRTQLVSLVTSNLLGFNAPAIATVEAEYEQMWAQDVAAMFGY… |
| A0A1A6BAV3 | 67-287 | None |
| A0A1X1UVZ9 | 2-194 | None |
| A0A1X1V7L5 | 65-307 | None |
| A0A5B1BNX8 | 96-321 | None |
| X8F185 | 67-281 | None |
| A0A654TKF2 | 2-229 | None |
| A0A7U8Y924 | 148-390 | None |
| A0A2Z5TK05 | 5-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.