DPCstruct | MC20429
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 229 ± 52 aa |
| Standard deviation of domain lengths | 52.36 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 85.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 61.78 |
| Pfam Score | 97.22 |
| Assigned Pfam label(s) | PF10598- PF08083 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7CYA6 | 2-203 | WWLWLFFLRGIVPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMRDVLEAMPEGIKQNKARTILQHLSEAWRCW… |
| A0A0D2K823 | 131-316 | MWRVWLFFLRGIVPLLERWLGNLLARQFEGRQSKGVAKTVTKQRIESHFDLELRAAVMHDILDMMPEGVKQNKAKTILQHLSEAWRC… |
| A0A1S4BZA2 | 84-370 | None |
| A0A0M3JEX6 | 1-185 | None |
| A0A1D6LLL6 | 221-377 | None |
| A0A2H1CAH6 | 620-920 | None |
| A0A251RZF6 | 1-149 | None |
| A0A0C2YYA8 | 9-168 | None |
| A0A426YIR1 | 217-406 | None |
| A0A7J6RK88 | 43-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.