DPCstruct | MC20427
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 119 ± 16 aa |
| Standard deviation of domain lengths | 15.95 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M4LNV9 | 18-107 | PSTPEPESTPRVPVEAAVFAPPIKAYDNHDLCQAWSRSYGWLEGAESLALQAYIVTLRQAYLDELEFRDPAGLRAWLDSGPRPRGGP… |
| A0A7X5VBR3 | 1-132 | MFGLSSLIGAAVLPLAVLMGVTSPGAVVWWRARRRLSMPPGSVQNVSERRAASRAGLREPTAPAVEAMTDRELCLAWRRSYVELEHA… |
| A0A1M7TLV3 | 118-231 | None |
| A0A6I1PE92 | 56-186 | None |
| A0A848KJ28 | 115-216 | None |
| A0A7V9DU87 | 2-133 | None |
| A0A1H4ZCS6 | 19-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.