DPCstruct | MC20423
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 193 ± 28 aa |
| Standard deviation of domain lengths | 28.32 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 18.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N7M3N9 | 9-189 | NPGILKLELFCKGMRIDPSCDLGNDARLVSRIRAGLGSGLEMILPDNLYANIPILEEFAKKSPFLLIKRSGRYYITKEGSDLCQVTI… |
| X1ACY9 | 3-200 | GNTMDAEEILRLKVRLLTEGATLSQDVYAGRKGGAGPIGGRYFILPNGRSVGIPIRTDEQQKIFNSATLVPTDDPTIWLYDNSIEMK… |
| A0A3M2FJZ8 | 1-204 | None |
| A0A3A0CDT3 | 8-254 | None |
| A0A534RL87 | 1-154 | None |
| N1U1W9 | 29-233 | None |
| A0A0A8WW56 | 26-224 | None |
| A0A1Q7W9F9 | 1-186 | None |
| A0A520ELV8 | 2-210 | None |
| A0A062UVB9 | 2-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.