DPCstruct | MC20422
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 116 ± 22 aa |
| Standard deviation of domain lengths | 22.40 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 92.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08882 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A259ARH2 | 16-114 | LPLGPKLFIVQRKDNKQWKIRSECGHDFCDWRQNWKLFAKVHVRDTQQKLEEIYPRLMAQTSTWQVLREYYCPECGTLHDVEAPTPW… |
| A0A523C4A7 | 40-145 | AKDLKPVGKGEIREVLFKLTPYVNVALDSTGKKVTVCSECGFIYGPAGEDFKLYSLVYERDPDEVYPKHLAPDKEWAVLLEFYCPGC… |
| A0A239MYY8 | 194-307 | None |
| A0A538A926 | 641-763 | None |
| A0A6J7S6W3 | 236-357 | None |
| A0A0K2RAX4 | 85-174 | None |
| E7G305 | 3-95 | None |
| A0A7V9I3U4 | 292-430 | None |
| A0A535AXN0 | 222-401 | None |
| A0A534RMF7 | 82-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.