DPCstruct | MC2042
Metacluster Properties and Pfam Annotations
| Number of structural domains | 96 |
|---|---|
| Mean domain length (aa) | 240 ± 38 aa |
| Standard deviation of domain lengths | 37.65 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 13.26 |
| Pfam Score | 32.14 |
| Assigned Pfam label(s) | PF12137- PF11079- CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N0X2D6 | 8-221 | APVCLELDLDSYDGPWTHVERFRGRSGWLVVAEACLVSEDDEWTTTIVAACDDYGDTVPVFMAPNLMACACSLPAHCDELPPDELDD… |
| A0A7I0IKE5 | 18-233 | LALQNDSLEFLAFGHPLIDKTVSYLIQNQKGWSTSFHSVSNKEYYVFLVEFQFSLKRTELFYFEVNPRTGTVKRIEELPEELRESQT… |
| A0A7C6KJ98 | 27-285 | None |
| A0A0M2UV53 | 7-260 | None |
| A0A381G2H7 | 1-164 | None |
| D5WV59 | 9-265 | None |
| A0A1V3WJG3 | 3-230 | None |
| A0A1V3WFJ3 | 3-230 | None |
| A0A7X8U477 | 136-379 | None |
| A0A7C6J4C9 | 18-293 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.