DPCstruct | MC20415
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 120 ± 16 aa |
| Standard deviation of domain lengths | 15.97 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G9ZDA0 | 1-101 | MTHKSFITALAFGSATLAGGASLDFDPAQYSEKTATINGETVTYRAYENIPYVANPVDAAHQTINIYIPAAYYNGGSINGYTAATAP… |
| A0A345D8W3 | 4-132 | SNKLALTLMALAAQSLSAQAQPTMPETPTVAPQNATTNSGTDLTYNLNFANATHTSKSLTLGGQTIAFRAYENIVYVQHPVDTKYER… |
| A0A134C424 | 507-653 | None |
| E7N1K2 | 3-110 | None |
| A0A378TTB4 | 2-125 | None |
| A0A1H6GRR9 | 2-110 | None |
| A0A3R8LPY1 | 31-129 | None |
| A0A348YLV2 | 10-127 | None |
| A0A4R2EP10 | 1-112 | None |
| A0A0F4W4D8 | 1-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.