DPCstruct | MC20413
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 98 ± 18 aa |
| Standard deviation of domain lengths | 17.88 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 69.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 46.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0482 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446R3N4 | 6-98 | QGGGWMMECWGAVTELRSCTSEIVLFFLNGESYLGRDCCIAIRTVTLHCWPSMLASIGLTAQEADILRGFCDAEIPHAPPPPAPAAV… |
| A0A4Y7K8M3 | 28-128 | GSPISLAARLQSTGSYSECWDSLMELQACSGEVILFFLNGETHLGTSCCQAILIIQNSCWPAMLGSLGFTQEEGDILHGYCDASANG… |
| A0A6A1V2R6 | 1-77 | None |
| A0A6A1VDR1 | 2-125 | None |
| A0A7J7MXN0 | 124-223 | None |
| A0A2Z6N5I0 | 1-85 | None |
| A0A484N5G0 | 29-106 | None |
| A0A6A1VET7 | 1-73 | None |
| A0A4Y7JAI8 | 39-140 | None |
| A0A2H5PMN4 | 8-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.