DPCstruct | MC20412
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 119 ± 6 aa |
| Standard deviation of domain lengths | 6.39 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 71.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446QWX9 | 1-127 | MQIDIDRDELLRQNSSAYAQALNIAVRGLHRMGALFSHLAMSITSGLIDDDTISVLFGIFWPLLEKLSQSSHMENTSLSTAACRSLS… |
| A0A835HYQ4 | 51-174 | IDEDNRHSLRQNPANYSQAVNFAARGLYRMGTVFSYLAISSSTGPINNDTILALLGVFWPILEKLLNSVHMENGSLSASACRALSQA… |
| A0A453I271 | 2-109 | None |
| A0A453I1U1 | 50-171 | None |
| A0A835PX36 | 88-201 | None |
| A0A453I1S4 | 177-298 | None |
| A0A446QX27 | 144-267 | None |
| M5WSJ9 | 2-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.